SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A061AKI6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061AKI6
Domain Number 1 Region: 1005-1103
Classification Level Classification E-value
Superfamily PX domain 1.96e-25
Family PX domain 0.00033
Further Details:      
 
Domain Number 2 Region: 459-603
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0000000000000134
Family Regulator of G-protein signaling, RGS 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A061AKI6
Sequence length 1362
Comment (tr|A0A061AKI6|A0A061AKI6_RHOTO) RHTO0S03e02344g1_1 {ECO:0000313|EMBL:CDR38047.1} OX=5286 OS=Rhodosporidium toruloides (Yeast) (Rhodotorula gracilis). GN=RHTO0S_03e02344g OC=Microbotryomycetes; Sporidiobolales; Sporidiobolaceae; Rhodotorula.
Sequence
MPPQLSYRGAGALVVLAVLLGSKARGLNPLVSLAWLLLYAVAGVVAVLGGQLWLAKVHER
RFSGFGSQDGSGEGSLLSLRPGRRRGPPPLQFTSPAAWDMTQTKAKWEATATANRLSFPG
APPFLSAAIDSLLHLILRDFVEKWYSTISDSPVFPNAVDATIRESLLAISSRVGKVDWSD
VLVGRILPLLTTHFERFDIAEKTVHGRGPRAGTPDSDEFDLFVASRYAQESEEKRLHPAV
DAASPNSRPAEEAWIRSTFEAILPLVLPEREVDSPAVRIMVREIVACAVVFPIIEMLSDP
DFANRLIDDKAGAAIRDQKMVNEFREALNKQESTMMAASARTLPSAASSPPKRRTEVVTV
RTGSRQFDAWLKSIGRCASLQEARRLKSDVSGQIRRAKILTDGKELDDVVDGVKVAEWID
FIERLYTAKRKIDKRIDKLGGNQGLSRAPSILGNLNSHLDSPVKLSDMLVDPTAVTYVME
FLERRRHADRAQFWLIVEGLKDPLDGIESDESLATAATSAFEDIQMIWSAYLVGNPFRSS
EGHLRAVQAFAEQEDPQNATPQMLRQVRHALFAIQREVLSLLEEEDAPAFSRSDLYFKAL
SALPVADESVMTPSTKTAPLPLVTPPTPAGRTGLSRARSRSNPQLQNTSALSTTISSSHA
ATARPPSPGFLVSPTAARKDTAPPQVTFHAAFNRARSQDLFEATTSSFEPMRKVSSGSLE
TIASASTYPSAKRKSNAMTDSLDFLISPQAVETERSPLFGSESTPDDTVTPPSDDDFVQV
QTIEAIQEALNSILASDGRTQPQANQSTTSLPSLRDTSLLPPPRRTSTNASSRSSGPATP
ALSSSTNLPSRLTTAPRSSSQSSSTAPQRAATRTVFDDTEAADDDGSGADLVEEPASDDF
SVSLPASGNLSLAAEIPRLADLLEKLRKQEIVVDALIRKAELTGVASELKVLVKSRESLR
REIRAATFQKEQLESQAAQNELSPSRTRITIPATTVGQASAAASGATFQLYLIEVHTLTD
EGAFQSGWITTRRYSEFLSLYNKLKEKFPSTCILDFPSKRLVGAWSKEFIEQRRVGLERY
LQNVIKVPAVCVSDELRSFLSKETVALPKSDVPRRVVPPLLPGQGLVRSLYRGLTTGIDD
VLGTSTSSMVEQMVNRLSQQAAEFAGIAAGSVLDEDLVGQVLADSVSHLPGVERPGDEGL
TYFTAPICDLFVTIFELKEKNNWLRRQAILIVLQQVLGGTIERKFRDSIKLLLAPPQLAT
YVAALQNGMWPDGELKPKESPRTAAEKAATKASASRKLADLLPDVAASLIGRHNAKQGAR
RLFSVLQNKRLNKHLIYGIADEIFAVVFPEINEPKARPLFLA
Download sequence
Identical sequences A0A061AKI6 M7X5V7
XP_016276830.1.102030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]