SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A061ATA6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061ATA6
Domain Number 1 Region: 3-105
Classification Level Classification E-value
Superfamily SNARE-like 4.76e-33
Family Sedlin (SEDL) 0.0000408
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A061ATA6
Sequence length 105
Comment (tr|A0A061ATA6|A0A061ATA6_CYBFA) CYFA0S02e03422g1_1 {ECO:0000313|EMBL:CDR38589.1} OX=36022 OS=Cyberlindnera fabianii (Yeast) (Hansenula fabianii). GN=CYFA0S_02e03422g OC=Saccharomycetes; Saccharomycetales; Phaffomycetaceae; Cyberlindnera.
Sequence
MKELNPFVVHAALDVVDDVQWKTNALYLKAIDDFYGYAISTFVTPGNIRFLLLHETRNEE
GIRQFFNDVNDLYVKTLLNPFYNVNDPITSPVFDVKVKALAKKYL
Download sequence
Identical sequences A0A061ATA6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]