SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A061B8S1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061B8S1
Domain Number 1 Region: 295-416
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 7.99e-33
Family cAMP-binding domain 0.00032
Further Details:      
 
Domain Number 2 Region: 173-292
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.54e-29
Family cAMP-binding domain 0.0000822
Further Details:      
 
Domain Number 3 Region: 3-37
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000366
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A061B8S1
Sequence length 426
Comment (tr|A0A061B8S1|A0A061B8S1_CYBFA) cAMP-dependent protein kinase regulatory subunit {ECO:0000256|PIRNR:PIRNR000548} KW=Complete proteome; Reference proteome OX=36022 OS=Cyberlindnera fabianii (Yeast) (Hansenula fabianii). GN=BON22_3958 OC=Saccharomycetes; Saccharomycetales; Phaffomycetaceae; Cyberlindnera.
Sequence
MSLPKDYVTELNELNKEVLRQQPADVLQFCANYFLGRLEEQRKHQWGLEPKARTLGISLF
PQRSQNSGSTATPETEQQPLFKQPFGDNDPHTRADDEDPSAPGLFKTDFAVGGETGGHAN
TTVDPIASEPFRRSSVTTPQSVNIPSSFNANRRTSVSAETLNPNGIHDDWKAPVIPKTAE
QLARLSVAVARNFLFSALDADSLSTVIGALKEVKLTAGSEVIKQGDEGDYFYVLEEGKVS
FLVDGTEVASSGPGSSFGELALMYNSPRAATVLAETDVTLWALDRLTFRRILLAKTSRKR
QMYESFLKEVPVLSRLSSYERSKLADALETESYKPGEVIIKEGEVGENFYLIENGEAEVS
KSAEGVLTKLKRGDYFGEVALLNDTPRQASVIATTAVEVATLGKSGFQRLLGPAVEVLKR
QDPTKH
Download sequence
Identical sequences A0A061B8S1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]