SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A061BHR2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061BHR2
Domain Number 1 Region: 62-111,269-348
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 4e-20
Family Regulator of G-protein signaling, RGS 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A061BHR2
Sequence length 476
Comment (tr|A0A061BHR2|A0A061BHR2_CYBFA) CYFA0S23e01750g1_1 {ECO:0000313|EMBL:CDR46512.1} KW=Complete proteome; Reference proteome OX=36022 OS=Cyberlindnera fabianii (Yeast) (Hansenula fabianii). GN=BON22_4245 OC=Saccharomycetes; Saccharomycetales; Phaffomycetaceae; Cyberlindnera.
Sequence
MPFSSPTKHTLLPHADVNDLTVKDVNVSQHSFDNLLGNERYNSQYYDQGGDAHSSIRQEV
TYQPLRRLPTLYEVLNRRSKSPVDLWGFYIFMRDYQNAVDYLDFWIDCITHLRLCKDYVK
GLRESLIISERHKSSSDEKHKSTSSEKAENVRESVSSSLLLEALLSEGLLDDKDNKRVSS
FLQGNEYINTSDPRISSIFSPQEEEPLTSTAQPQSPFKDVYEPLSTPEKVFAGDIQRRSS
NKDIFTQDRRSTRIVPEQLEKYIANVKNGNINRATLKSSSRNILNTYFQDTSPKRLNIPD
RIIRKIRHDIDLQGRDDPDVFEDAKNYVYSAMERESFSHFLHHYALHNLGNRSCLVRLIL
GLFLLFAGFWIAYCLIFTNIKPKAIRAVLIVPFFLGVYLILTFFYRLDPLMVLFRYSDNP
ELAIHKNQRRKHFVKNLYEPFVVSLQKKRALWILLLTCLISAAFSVLFGLVPGHRI
Download sequence
Identical sequences A0A061BHR2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]