SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A061CG61 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A061CG61
Domain Number - Region: 2-42
Classification Level Classification E-value
Superfamily R1 subunit of ribonucleotide reductase, N-terminal domain 0.0011
Family R1 subunit of ribonucleotide reductase, N-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A061CG61
Sequence length 61
Comment (tr|A0A061CG61|A0A061CG61_LACDL) Uncharacterized protein {ECO:0000313|EMBL:CDR80645.1} KW=Complete proteome OX=29397 OS=Lactobacillus delbrueckii subsp. lactis. GN=LBCNRZ333_02865 OC=Lactobacillus.
Sequence
MQFTKQFEGTFAQVKEQIDKFVAEGGHIDAVITDHTGEKVTEDHTFGYKMRVIAICSEEE
S
Download sequence
Identical sequences A0A061CG61 A0A0R2N3T3 A0A1F1R1S5 A0A1L3KDK7 A0A2I1SP92 D8FNM7 E4SXY0 F0HVB4 S2KB46
gi|313124547|ref|YP_004034806.1| WP_002879841.1.101331 WP_002879841.1.13955 WP_002879841.1.14566 WP_002879841.1.16105 WP_002879841.1.26456 WP_002879841.1.29271 WP_002879841.1.2973 WP_002879841.1.54236 WP_002879841.1.55315 WP_002879841.1.60893 WP_002879841.1.65591 WP_002879841.1.87340 WP_002879841.1.87357 WP_002879841.1.89575 WP_002879841.1.89861 WP_002879841.1.92308 WP_002879841.1.9897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]