SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A061CUN9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061CUN9
Domain Number 1 Region: 2-73
Classification Level Classification E-value
Superfamily MgtE membrane domain-like 0.000000000000122
Family MgtE membrane domain-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A061CUN9
Sequence length 73
Comment (tr|A0A061CUN9|A0A061CUN9_PSEPS) CBS domain containing protein {ECO:0000313|EMBL:CDR92336.1} KW=Complete proteome OX=330 OS=Pseudomonas pseudoalcaligenes. GN=PPSAL_3109 OC=Pseudomonas oleovorans/pseudoalcaligenes group.
Sequence
MIVWLWRGEAWTGLIIGCSILLSLGAACLLGLSVPTLLHALRLDPKIAAGPVTLAVTDLC
TLLFYFSLAAWLL
Download sequence
Identical sequences A0A061CUN9 A0A1H7CY52 A0A225DBX9 W6RIU8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]