SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A061DGP8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061DGP8
Domain Number 1 Region: 2-133
Classification Level Classification E-value
Superfamily Histone-fold 2.35e-56
Family Nucleosome core histones 0.000000816
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A061DGP8
Sequence length 136
Comment (tr|A0A061DGP8|A0A061DGP8_THECC) Histone H3 {ECO:0000256|RuleBase:RU004471} KW=Complete proteome; Reference proteome OX=3641 OS=Theobroma cacao (Cacao) (Cocoa). GN=TCM_000234 OC=Theobroma.
Sequence
MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSHAVLALQEAAEAYLVGLFEDTNLCAIHARRVTI
MPKDIQLARRIRGERA
Download sequence
Identical sequences A0A061DGP8 A0A067FUS7 A0A1Q3C719 A0A1U8K381 V4SIW6
XP_006425525.1.91645 XP_006466922.1.29302 XP_016696922.1.88148 XP_017627466.1.75545 XP_021274158.1.83089 clementine0.9_025102m|PACid:19285203 orange1.1g032654m|PACid:18099033 orange1.1g032668m|PACid:18099034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]