SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A061DTI1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061DTI1
Domain Number 1 Region: 66-205
Classification Level Classification E-value
Superfamily Chlorophyll a-b binding protein 1.44e-30
Family Chlorophyll a-b binding protein 0.00000265
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A061DTI1
Sequence length 206
Comment (tr|A0A061DTI1|A0A061DTI1_THECC) Chlorophyll a-b binding protein, chloroplastic {ECO:0000256|RuleBase:RU363080} KW=Complete proteome; Reference proteome OX=3641 OS=Theobroma cacao (Cacao) (Cocoa). GN=TCM_004912 OC=Theobroma.
Sequence
MLVPHKPIRSERGWRFTWIGLGTSPDPIRVFQCTDTAFQPVFAAAMVASMRKTAGKPAAP
SGSPWNRPDRGEFPGDYGWETAGLSDRVISGWSRLSRESSLIHAQSISAVRACQVILMGE
VEGYRIAAGPLGEVTDPLYPGGGFDPLGLAELMVKEIKDGWLAMFSIFRFFVQAIATGKG
PLENLGDRLADPVHNNAWAYATNFVP
Download sequence
Identical sequences A0A061DTI1
CGD0002821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]