SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A061DWM2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061DWM2
Domain Number 1 Region: 3-91
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000392
Family B3 DNA binding domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A061DWM2
Sequence length 117
Comment (tr|A0A061DWM2|A0A061DWM2_THECC) Uncharacterized protein {ECO:0000313|EMBL:EOX97169.1} KW=Complete proteome; Reference proteome OX=3641 OS=Theobroma cacao (Cacao) (Cocoa). GN=TCM_006256 OC=Theobroma.
Sequence
MELFTKRLTQTDIDKRLAIPTNSLVYFPGFKGNHSVELKVKDKSHRLWTFRCSIRKKRYL
KPVFSSGWLEFIRSNNLRIGDKVSVRLEQGHVSGVEYGIEVQRKIRLLGKDVWADVL
Download sequence
Identical sequences A0A061DWM2
Tc00_g049980

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]