SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A061E354 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061E354
Domain Number 1 Region: 59-187
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 1.29e-40
Family Pollen allergen PHL P 1 N-terminal domain 0.00016
Further Details:      
 
Domain Number 2 Region: 188-224
Classification Level Classification E-value
Superfamily PHL pollen allergen 0.00000017
Family PHL pollen allergen 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A061E354
Sequence length 243
Comment (tr|A0A061E354|A0A061E354_THECC) Expansin B1, BETA 1.5 isoform 2 {ECO:0000313|EMBL:EOX99395.1} KW=Complete proteome; Reference proteome OX=3641 OS=Theobroma cacao (Cacao) (Cocoa). GN=TCM_008076 OC=Theobroma.
Sequence
RFILILQNSRLKQVVAPPVDTMQRRRGFIGVVALCCLVLLECLMVSGKVPAPGKVSDLHW
HPATATWYGSPDGDGSDGGACGYGSLVDVKPLRARVGAVSPVLFKSGEGCGACYKVRCLD
KSICSRRAVTIIVTDECPGGYCANGRTHFDLSGAAFGRMAINGESAQLRNRGELPVVYRR
TPCKYPGKNIAFHVNEGSTDYWLSLLVEFEDGDGDVGSMHIREVTFGVPHRTAPCLFLIR
PSD
Download sequence
Identical sequences A0A061E354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]