SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A061EJK0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061EJK0
Domain Number 1 Region: 307-411
Classification Level Classification E-value
Superfamily ApaG-like 8.24e-20
Family ApaG-like 0.00079
Further Details:      
 
Domain Number 2 Region: 5-76
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000235
Family F-box domain 0.0074
Further Details:      
 
Domain Number 3 Region: 96-200
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000628
Family SMI1/KNR4-like 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A061EJK0
Sequence length 469
Comment (tr|A0A061EJK0|A0A061EJK0_THECC) SKP1/ASK-interacting protein 16 isoform 4 {ECO:0000313|EMBL:EOY04828.1} KW=Complete proteome; Reference proteome OX=3641 OS=Theobroma cacao (Cacao) (Cocoa). GN=TCM_019997 OC=Theobroma.
Sequence
MEREVGLDQLGDLALHIILSKLGPEDTVRVSCVSRRLRLSTSEDSLWALFCFQDLQLSTP
QDHQGNPASSFKAAYQLWREAFAMYPWPLVKRVKRCWDKLKNWLSNDFPEVEATLRSGAS
ESDIQQLETRLKVKLPLPTRLLYRFHDGQERTDEGHSSTWLGSSLGIIGGYSFYNHLVNV
YLLPISQVIEGTRMVIRHLGFSSRSKYIVVAASAYRPKKFFLNCTNGQLYVGTSNLPTDG
EMIQCVPNALIRSVHDLHGDQQQDAMLLWLEEHGRRLENGIIKVCEEGNVRSISLFPEVP
PLCSTAVTNGVQVRASAAFVPELANLQDSAEKYLFAYSIRMSLLPGGCIIDGMTFSSCQL
NWRHWIIRANEAIISDVNGEAVIGQFPLLHPGEDEFVYESCTPLSSSSGWRTRKEGHLTF
KWQGSPCRSQIMFSDKLLHSFLDSMLSPWFWKILSDNKYERLRHCETLF
Download sequence
Identical sequences A0A061EJK0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]