SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A061F2E6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061F2E6
Domain Number 1 Region: 201-244
Classification Level Classification E-value
Superfamily Ribonuclease H-like 0.00000209
Family Retroviral integrase, catalytic domain 0.023
Further Details:      
 
Domain Number 2 Region: 102-137
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000706
Family Retrovirus zinc finger-like domains 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A061F2E6
Sequence length 244
Comment (tr|A0A061F2E6|A0A061F2E6_THECC) Uncharacterized protein {ECO:0000313|EMBL:EOY08654.1} KW=Complete proteome; Reference proteome OX=3641 OS=Theobroma cacao (Cacao) (Cocoa). GN=TCM_023546 OC=Theobroma.
Sequence
MTSIREAKDLNVITLDEICGSLLTHELELKEEKEEDKREAKEKKKCTALKASILKVELEE
LSCDDDEELALVARKFKKLMGKINRRLGRRGFRTDQSASWKIKNKNDSNKNEELICYEYK
KPGHFKFECPLLKDKTPKKNKKSKKEMVAIAWSNSDTSSSKAEDEKSEERANIYLMAQDD
ETEVSLSPCDISIDDLQDKKVENEKGLAIVSIRSDHGRAFENDEFEEFCNKKGLDHNFSA
PRTP
Download sequence
Identical sequences A0A061F2E6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]