SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A061FMF7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061FMF7
Domain Number 1 Region: 33-134
Classification Level Classification E-value
Superfamily Histone-fold 1.07e-40
Family TBP-associated factors, TAFs 0.0000691
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A061FMF7
Sequence length 179
Comment (tr|A0A061FMF7|A0A061FMF7_THECC) Nuclear transcription factor Y subunit B-10 isoform 1 {ECO:0000313|EMBL:EOY18520.1} KW=Complete proteome; Reference proteome OX=3641 OS=Theobroma cacao (Cacao) (Cocoa). GN=TCM_043066 OC=Theobroma.
Sequence
MADGMQAGPTSPAGGSHESGGEQSSPHSNVREQDRYLPIANISRIMKKALPANGKIAKDA
KDTVQECVSEFISFITSEASDKCQKEKRKTINGDDLLWAMATLGFEDYIEPLKVYLGRYR
ELEGDTKGSARGGDGSLKRDAAGGLAAQNAQFAIQGSLNYITSQAQGQHMIVPSMHGNE
Download sequence
Identical sequences A0A061FMF7
XP_017985159.1.67643 Tc10_g004870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]