SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A061G4E0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A061G4E0
Domain Number - Region: 270-369
Classification Level Classification E-value
Superfamily TPR-like 0.00455
Family Tetratricopeptide repeat (TPR) 0.083
Further Details:      
 
Domain Number - Region: 89-188
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0379
Family Pseudo ankyrin repeat 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A061G4E0
Sequence length 483
Comment (tr|A0A061G4E0|A0A061G4E0_THECC) Tetratricopeptide repeat-like superfamily protein, putative isoform 1 {ECO:0000313|EMBL:EOY24258.1} KW=Complete proteome; Reference proteome OX=3641 OS=Theobroma cacao (Cacao) (Cocoa). GN=TCM_015917 OC=Theobroma.
Sequence
MPILSLSRFISISISSKPNKIFTFLFSTASSADKFFTHLQKKQSNIEKTLALVNSKLDSN
CVCEVLERCCFDKSQMGLRFFIWAGLQSNYRHSSYMYSKACEFLKIKQNPFLVLDVIEAY
KVEKCLVNVKMFKVVLNLCREARITDEALLVLRKMPEFNLRPDTTTYNVVIRLICEKGDM
DMADKLMKDMGLIDLYPDMITYLAMIKGFCNAGRLEDACGLFQVMREHGCFPNAVAYSAL
LEGICRYGSVEKALELLGEMEKEGDGCSPNVITYTSVIQSFCEKGQTTKALRVLDRMGTC
GCAPNRVTVSTLIKRLCAEGHVEEAYKLIDKVVPGGGVSDGDCYSSLVVSLIRIKRLDEA
EKLFRKMLATGAKPDSIACSIMIREICQEGRVLDGFYLYEEIERMRYLSSIDADIYSILL
VGLCRQSHSVEAAKLARSMLEKRIRLKAPYVDKIIEHLKNCGDKQLVTELGRIGRILFRM
ILV
Download sequence
Identical sequences A0A061G4E0
CGD0016267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]