SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A061GST1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061GST1
Domain Number 1 Region: 151-207
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.1e-16
Family HLH, helix-loop-helix DNA-binding domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A061GST1
Sequence length 211
Comment (tr|A0A061GST1|A0A061GST1_THECC) Basic helix-loop-helix DNA-binding superfamily protein, putative isoform 4 {ECO:0000313|EMBL:EOY32571.1} KW=Complete proteome; Reference proteome OX=3641 OS=Theobroma cacao (Cacao) (Cocoa). GN=TCM_040564 OC=Theobroma.
Sequence
MGDYGGVNNSNREASFPSASRPPPSGLMSPIAEMGNKNVVPNSSENAGFGENRHNNYSSG
FPVTSWEDSMMISDNMPGVKRLREDDRSLSGLDLDGAETQNTDAGNRPPPILAHHLSLPK
SSAEMSAIDKFLQYQDSVPCKIRAKRGCATHPRSIAERVRRTKISERMRKLQDLVPNMDK
QTNTADMLDLAVDYIKDLQNQVKTLSDNRAK
Download sequence
Identical sequences A0A061GST1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]