SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A061H9I3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061H9I3
Domain Number 1 Region: 168-258,285-352
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000379
Family SMI1/KNR4-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A061H9I3
Sequence length 830
Comment (tr|A0A061H9I3|A0A061H9I3_9BASI) Uncharacterized protein {ECO:0000313|EMBL:EPQ28690.1} KW=Complete proteome; Reference proteome OX=1277687 OS=Anthracocystis flocculosa PF-1. GN=PFL1_03993 OC=Ustilaginomycetes; Ustilaginales; Ustilaginaceae; Anthracocystis.
Sequence
MLAKQRPADKMPGPSIFTQISSFFGGAQNQSPFGGQRKTSTFGSGLPSSSRRGPPASLNT
NAWSQPYNGAYSQDSPTVLSPGAGQYPPPRSTSPYQMAAQSPSSFSTTSVGDFTNLHPSA
SSSTLVPPVNGRSARSGIGGGGGGASAARSATGVMIPSTAYPPLRHTWNRIRAWCDDHYE
EIADTLNWPATEEALDELEMTIGFALPAAVRESYLCYDGQELESNQSCQDGLFFGLPLLS
VEEIAEEWRFWRAVDEDPETGSNPHVRAKMSSCPHKWVRAEYSCRGWIPLITDRAGNYIG
VDLAPHPSGGGAPGQVIIFGRDFDTKVVAWRGEGEGGWGRFLQSLAEELESGELWSLDEP
SSGSDDEEDAIGYESYFAGGAGGGASRGGGDRTGEGVAGFRLAGEYKAWPVLEAWADKSI
KHWESVGLAPGRPVGDDTMPRLRMVDENGEALDAEGSQRSRRGSSVMHADDEQPIIAAPH
PLEEAAGSALDTGDTSSTQMLPDADAGAVGVNGDAGSDGGNITPTNSGRLLGKMLSPPLP
QTRSSRKQKQRGEGWGAPQLGSPQLDQAQXXXXXXXXXVKAVHAAVLASDGRSHSVQFDD
SAVPSGNRASYSNPGYRDVVGAGGRSAAAARRVDSLELDSRSSVERAASASSAAATGDAA
TMGGGHFGSGGRGRGGLGTDSSAEDSNSTFSGNLNDDPLRVGVGMTSGGVVEGRHSTSTA
ATSPRMSSEQREPLAVGLSDPTMAAAVDAVQGLKLQSSSDEVPALIGTHSLPGSPVKSTF
GGATSAVINPSPLNPAVSGASHLPEANGTAVAAGAKCSTSIDSEVSLAMA
Download sequence
Identical sequences A0A061H9I3
XP_007879707.1.23263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]