SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A061HDU8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061HDU8
Domain Number 1 Region: 8-149
Classification Level Classification E-value
Superfamily Cyclin-like 3.18e-29
Family Cyclin 0.015
Further Details:      
 
Domain Number 2 Region: 151-207,246-285
Classification Level Classification E-value
Superfamily Cyclin-like 5.79e-24
Family Cyclin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A061HDU8
Sequence length 303
Comment (tr|A0A061HDU8|A0A061HDU8_BLUGR) Cyclin-like component of the RNA polymerase II holoenzyme {ECO:0000313|EMBL:EPQ62875.1} KW=Complete proteome; Reference proteome OX=1268274 OS=Blumeria graminis f. sp. tritici 96224. GN=BGT96224_4767 OC=Erysiphales; Erysiphaceae; Blumeria.
Sequence
MAANYWESTQRRHWKFTRPQLQQLRKNLEDKEPKLVQIYPLPEMRHLSIYFNQQVIRLGK
RLGIRQQAMATAQLYIRRFYCKVEIRCTNPYLVIATATYLACKMEECPHHIRLVVSEGRT
LWPEYFSNDTSKLGECEFFLISEMTSQMIIHHPYRSLNSLQGTFSLSQDESTLAWTIVND
HYMTDLPLMFAPHTVAVVAILLALVLRPSAGGPAYGSGNLAKAANGILKTVKQEKLDGDK
NSGGGRNKLARLVSWLAESDVNIEDIIDCTQEMISFYEFHEQYNEKLTREQINRFVKARG
LDK
Download sequence
Identical sequences A0A061HDU8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]