SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A061HFB1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061HFB1
Domain Number 1 Region: 85-225
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 5.49e-31
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.078
Further Details:      
 
Domain Number 2 Region: 19-97
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.0000000000048
Family Poly(A) polymerase, PAP, N-terminal domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A061HFB1
Sequence length 274
Comment (tr|A0A061HFB1|A0A061HFB1_BLUGR) Uncharacterized protein {ECO:0000313|EMBL:EPQ63521.1} KW=Complete proteome; Reference proteome OX=1268274 OS=Blumeria graminis f. sp. tritici 96224. GN=BGT96224_230B OC=Erysiphales; Erysiphaceae; Blumeria.
Sequence
MVSDRFMQGGPPKFGSSPMQVRKFAYFLEQERVVLKGSQECVVKAKVPLVKYVDNITGLK
VDISFENTTGLVANKTFQCWRETFPAMPILVTVIKQFLAMRGLNEPVNGGIGGFSVACLV
VSLLQQMPQVQSRSMIPEHHLGEILMEFFDLYGNRFNTMTTAISVNPAGYFNKSELNITY
NKPMDKFSIIDPNNPANDIAGGSRNSVTIKRAFQHAYSDLQRRMGELQYLDPSKRRLKSV
LSCIIGGNYNSFKLQREHLAHVHEKKIGTTKNSG
Download sequence
Identical sequences A0A061HFB1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]