SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A061HJG2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061HJG2
Domain Number 1 Region: 68-167
Classification Level Classification E-value
Superfamily Rubredoxin-like 2.24e-30
Family Cytochrome c oxidase Subunit F 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A061HJG2
Sequence length 198
Comment (tr|A0A061HJG2|A0A061HJG2_BLUGR) Subunit IV of cytochrome {ECO:0000313|EMBL:EPQ65089.1} KW=Complete proteome; Reference proteome OX=1268274 OS=Blumeria graminis f. sp. tritici 96224. GN=BGT96224_2357 OC=Erysiphales; Erysiphaceae; Blumeria.
Sequence
MYLQRSALLAARRIAVTRPITRGLSISLARLTGEAPTPLNDGNTNSNSQKMKKFQEISSP
DDLLAPGAAPGTIPTDLEQAVGLERLEILGKMQGVDIFDMKPLDSSRLGTLENPIMVKSA
GEENYAGCTGFPADSHNVIWLTVSRTRPIERCPECGNVLKMEYIGPQEDDSHDSHHDHHS
YEEPKTFADFIHPEYRYR
Download sequence
Identical sequences A0A061HJG2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]