SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A061HLD9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061HLD9
Domain Number 1 Region: 299-421
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.81e-29
Family cAMP-binding domain 0.0002
Further Details:      
 
Domain Number 2 Region: 160-300
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.96e-26
Family cAMP-binding domain 0.0000536
Further Details:      
 
Domain Number 3 Region: 4-40
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000262
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A061HLD9
Sequence length 437
Comment (tr|A0A061HLD9|A0A061HLD9_BLUGR) cAMP-dependent protein kinase regulatory subunit {ECO:0000256|PIRNR:PIRNR000548} KW=Complete proteome; Reference proteome OX=1268274 OS=Blumeria graminis f. sp. tritici 96224. GN=BGT96224_1363 OC=Erysiphales; Erysiphaceae; Blumeria.
Sequence
MSLPPVFLSEIDTLTREVLLAKPSDILQFCANHFSKRLEKERTQLLSAKPKDSAMSENTF
PGRLGINPFGPESRVANSEKPSASHVVRATERDEDKVNPNFNNKPLKKFAGDKATNTPLQ
AFKLGASDGFPEHYGMGRRTSVSAESLNPTASSNESWTPPYHRKTPEQLERLKKSISGNF
LFNHLDDEQSAQVLGALVEKPIPVKDIKVISQGDQGDFFYVVEKGSFDVYVNPAGSVQPG
LGGLGNKVATIEPGGSFGELALMYNAPRAATVISAEGACTLWSLDRITFRRILMDSTFQR
RRLYESFLEEVTLLSTLTKYERSKIADALVTLKYPAGTTIIKEGDAGEEFYLLESGEAEA
FKAGSQNAVKCYSKGDYFGELALLNDAPRAASVVSKTEVKVAKLGKDGFQRLLGPVESIM
RRTKYEGVEEIDPLYQK
Download sequence
Identical sequences A0A061HLD9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]