SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A061HTH6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061HTH6
Domain Number 1 Region: 27-108
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000008
Family Growth factor receptor domain 0.0049
Further Details:      
 
Domain Number 2 Region: 200-243
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000706
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A061HTH6
Sequence length 351
Comment (tr|A0A061HTH6|A0A061HTH6_CRIGR) Uncharacterized protein {ECO:0000313|EMBL:ERE38661.1} KW=Complete proteome OX=10029 OS=Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus). GN=H671_21743 OC=Muroidea; Cricetidae; Cricetinae; Cricetulus.
Sequence
MSTFLRKRCLCLGFLLFHLFNQVSATQRCPSSCPLQCPTTPPTCAPGVRSVLDGCSCCLV
CARQRGESCSELKPCDQSSGLYCDRSADPSNQTGICMVLEGDNCVFDGVIYRSGEKFEPN
CQYRCACRDGQIGCVPRCQLDVLLPGPDCPAPRKVAVPGECCEKWTCGPNEQGTLGGLAL
PAYRPEATVGVEVSDSSVNCIEQTTEWSACSKSCGMGWSTRVTNRNRQCEMVKQTRLCMV
RPCEQEPTPPTDKKGKKCLRTKKSLKAIHLQFKNCTSLHTYKPRFCGVCSDGRCCTPHNT
KTIQVEFQCSPGQTIKKPVMVIGTCTCHSNCPQNNEAFLQELEPKSSRGEM
Download sequence
Identical sequences A0A061HTH6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]