SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A061HZR0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061HZR0
Domain Number 1 Region: 145-251
Classification Level Classification E-value
Superfamily R3H domain 1.96e-20
Family R3H domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A061HZR0
Sequence length 252
Comment (tr|A0A061HZR0|A0A061HZR0_CRIGR) R3H domain-containing protein C19orf22-like protein {ECO:0000313|EMBL:ERE72365.1} KW=Complete proteome OX=10029 OS=Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus). GN=H671_5g15065 OC=Muroidea; Cricetidae; Cricetinae; Cricetulus.
Sequence
MNPSLARRPLPGCLPTLGGSQVKRVSASRRKQHFINQAVRNSDLVPKAKGRKSLQRLENT
RCLLTLLETAGGPPGLEDGDLTPPAAPGIFAEACSNATYVEVWNDFMNRSGEEQERVLRY
LEDEGQGKRRPGRGPGRGEDRRREDPAFTPHECFRRISRRLRSVLKRSRIPMETLESWEE
RLLAFFSVSPQAVYTAMLDNSFERLLLHAVCQYMDLISASADLEGRRQMKVSNRHLDFLP
PELLLSAYLDQQ
Download sequence
Identical sequences A0A061HZR0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]