SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A061I1C6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061I1C6
Domain Number 1 Region: 424-540
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.7e-29
Family Nuclear receptor ligand-binding domain 0.00051
Further Details:      
 
Domain Number 2 Region: 227-284
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000124
Family TSP-1 type 1 repeat 0.0048
Further Details:      
 
Domain Number 3 Region: 394-425
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000326
Family Nuclear receptor 0.0031
Further Details:      
 
Domain Number 4 Region: 288-339
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000602
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Domain Number 5 Region: 48-108
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000876
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 
Domain Number 6 Region: 109-165
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000144
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 7 Region: 169-222
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000405
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A061I1C6
Sequence length 571
Comment (tr|A0A061I1C6|A0A061I1C6_CRIGR) Thrombospondin type-1 domain-containing protein 4 {ECO:0000313|EMBL:ERE74889.1} KW=Complete proteome OX=10029 OS=Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus). GN=H671_4g13080 OC=Muroidea; Cricetidae; Cricetinae; Cricetulus.
Sequence
MAWQLRTLTALPEDLGSISSTHMVDDNCLCVQNLGNLVMVNSIAYRLPTVSWDIGEWSEC
SKTCGLGMQHRQVLCRQVYANRSLTVQPYRCQHLEKPETTSTCQLKICSEWQIRTDWTSC
SVPCGVGQRTRDVKCVSNIGDIVDDQECNMKLRPNDIENCDMGPCAKSWFLTEWSERCSA
ECGAGVRTRSVVCMTNHVSSLPLEGCGNNRPAETTPCDNGPCTGKVEWFAGSWSQCSVEC
GSGTQQREVICVRKNADTFEVVDPYECSFLERPPSQQACHLKPCGAKWFSTEWSMCSKSC
QGGFRVREVRCLSDDMTPGSLCDPQLKPEERESCNPQDCVPEVDENCKDKYYNCNVVVQA
RLCVYNYYKTACCASCTRVANKHTGFLGSVGPSLQCRVCGDSSSGKHYGIYACNGCSGFF
KRSVILLEEAWNELFLLGAIQWSLPLDSCPLLAPPEASGGSQSRLVLASAEMRFLQETIS
RFRALAVDPTEFACMKALVLFKPETRGLKDPEHVEALQDQSQVMLSQHSKAHHPSQPVRV
SLCSPGCPGSRFADHTGLKLKGIHLPLPPEC
Download sequence
Identical sequences A0A061I1C6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]