SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A061I263 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061I263
Domain Number 1 Region: 2-118
Classification Level Classification E-value
Superfamily tRNA-intron endonuclease catalytic domain-like 4.97e-39
Family tRNA-intron endonuclease catalytic domain-like 0.00000054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A061I263
Sequence length 132
Comment (tr|A0A061I263|A0A061I263_CRIGR) tRNA-splicing endonuclease subunit Sen15-like protein {ECO:0000313|EMBL:ERE75233.1} KW=Complete proteome OX=10029 OS=Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus). GN=H671_4g12807 OC=Muroidea; Cricetidae; Cricetinae; Cricetulus.
Sequence
MGTHPKYLEMMELDIGDATQVYIAFLVYLDLMESKSWHEVNCVGIPELQLICLLGTEIEG
EGLQTVVPTPISASLSHSRIREILKASRKLQGDPELPMSFTLAIVESDSTIVYYKLTDGF
MLPDPQNISLRR
Download sequence
Identical sequences A0A061I263

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]