SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A061I282 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061I282
Domain Number 1 Region: 370-558
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.11e-64
Family Regulator of G-protein signaling, RGS 0.00000781
Further Details:      
 
Domain Number 2 Region: 767-996
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.09e-64
Family DBL homology domain (DH-domain) 0.000000000903
Further Details:      
 
Domain Number 3 Region: 1000-1130
Classification Level Classification E-value
Superfamily PH domain-like 2.19e-38
Family Pleckstrin-homology domain (PH domain) 0.00000127
Further Details:      
 
Domain Number 4 Region: 61-147
Classification Level Classification E-value
Superfamily PDZ domain-like 2.5e-17
Family PDZ domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A061I282
Sequence length 1589
Comment (tr|A0A061I282|A0A061I282_CRIGR) Rho guanine nucleotide exchange factor 12 {ECO:0000313|EMBL:ERE74689.1} KW=Complete proteome OX=10029 OS=Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus). GN=H671_4g13247 OC=Muroidea; Cricetidae; Cricetinae; Cricetulus.
Sequence
MSGTQSTITDRFPLKKPIRHGSILNRESPTDKKQKVERSTSHDFDPTDSSSKKTKASSEE
SRSEIYGLVQRCVIIQKDDNGFGLTVSGDNPVFQFISHTDGAAMRAGVQTGDRIIKVNGT
LVTHSNHLEVVKLIRSGSYVALTVQGRPPGSPQIPLADSEVEPSAIGHMSPIMTSPHSPG
ASGNMERITSPVLMGEENNVVHNQKVEILRKMLQKEQERLQLLQEDYNRTATQRLLKEIQ
ETKKHIPQLQEQLSKATGSAQDGTVIAPSRPLGDTLTVSEAETDPGDSLCRTDGSVGEAS
RPSSDNADSPKSSLKERIYLEETPDKSEGIQDTDTQSLVSSPFTRGAPHIIGAEDDDFGT
EHEQINGQCSCFQSIELLKSRPAHLAVFLHHVVSQFDPATLLCYLYSDLYKQTNSKETRR
VFLEFHQFFLDRSAHLKVSVPEEISVDLEKRRPELIPEDLHRHYIQTMQERVHPEVQRHL
EDFRQKRSMGLTLAESELTKLDAEKEKDRVTLEKERACAEQIVTKIEEVLMTAQAVEEER
SSTMQYVILMYMKHLGVKVKEPRNLEHKRGRIGFLPKIKQSMKKDREGEEKGKRRGFPSI
LGPPRRPSRHDNSAIGRAMEIQKLRHPKHLSAPSSVSPEPQDPAKLRQSGLAIEGTDTGY
LPASTISSATSGAALSQEGGKENDTGSKQVGEVSVPADCLDGTPRVSNTIFDFPPPLLDQ
VQEEECEVERVTEHGTPKPFRKFDSIAFGESQSEDEQFENDLETDPPNWQQLVSREVLLG
LKPSEIKRQEVINELFYTERAHVRTLKVLDQVFYQRVSREGILSPSELRKIFSNLEDILQ
LHVGLNEQMKAVRKRNETSVIDHIGEDLLIWFSGPGEEKLKHAAATFCSNQPFALEMIKS
RQKKDSRFQTFVQDAESNPLCRRLQLKDIIPTQMQRLTKYPLLLDNIAKYTEWPPEKEKV
KKAADHCRQILNYVNQAVKEAENKQRLEDYQRRLDTSNLKLSEYPNVDELRNLDLTKRKM
IHEGPLVWKVNRDKSIDLYTLLLEDILVLLQKQDDRLVLRCHSKILASTADSKHTFSPVI
KLSTVLVRQVATDNKALFVISMSDNGAQIYELVAQTVSEKTVWQDLICRMAASVKEQSTK
PIPLPQSTPCEGDNDEEEPSKLKVEHHGLSVTGLHSPDRVLGLESPLISSKPQSHSLNTP
GKSEAEHLFVTATQFAKEQCANGTLKEDDGSYPVPVPHPHLPVSEERWALDALRNLGLLK
QLLVQQLGLPEKSTQEDWQSFSRYGLVSEEGRAECGIQDSSVKVCPAEEGQMPFKTGTGD
VATCDSPRTSSESCVAQDSVILASQDSQASNILVMDHMILTPEMPTTEPEGGLDDSGEHF
FDAREAHSDDNPSEGDGAVKKEEKDVNLHISGKWLSHFNFDFGYCKLSYMLEWMLFQYLR
AVTTVINNSEITVEVCKGNCLILDGYDAVQESSTDEEVASSFALQPVTGIPSVDSTHQQQ
YSPQNAHSDGAVSPFTPEFLVQRRWRAMEDACFEIQSPSSCTDSQSQILEYIHKIEADLE
HLKKVEESYALLCQRLAGSALPDKLSDKS
Download sequence
Identical sequences A0A061I282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]