SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A061I471 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061I471
Domain Number 1 Region: 1-123
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 5.84e-28
Family Gelsolin-like 0.00062
Further Details:      
 
Domain Number 2 Region: 357-426
Classification Level Classification E-value
Superfamily VHP, Villin headpiece domain 3.53e-22
Family VHP, Villin headpiece domain 0.00068
Further Details:      
 
Domain Number 3 Region: 108-209
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 1.13e-21
Family Gelsolin-like 0.00088
Further Details:      
 
Domain Number 4 Region: 216-288
Classification Level Classification E-value
Superfamily Actin depolymerizing proteins 0.0000000000000221
Family Gelsolin-like 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A061I471
Sequence length 426
Comment (tr|A0A061I471|A0A061I471_CRIGR) Villin-like protein {ECO:0000313|EMBL:ERE76391.1} KW=Complete proteome OX=10029 OS=Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus). GN=H671_4g11867 OC=Muroidea; Cricetidae; Cricetinae; Cricetulus.
Sequence
VWCIQDFQRQSVDPKHHGQLCSGNCYLVLYTYQTLGRVRYILYLWQGHKTTIEDTKALNH
NAEELDIAYQGALVQAHVTMGREPPHFLAIFQGQLVVFQGSAGNGGKRLPISTTRLFHMQ
GADSHNTQTMEVPARASSLASSDIFFLITKDSGYLWFGKGCNGDQREMARKVVTVFTGHN
METVLEGQEPPHFWEALGGRAPYPSNKRRGASPLAGWVFLWLGEGAGERKKEAVAWGHEY
LRTHPAERSLDTPIILVKQGHEPATFTGWFVTWDPYKWTNNQTYEEVVERRPRPASAISE
ITAEVHNFQLTQWPTDNKGGPSTLLASRDSQDSPENDPELGLGVDGKNPSKSPSSHCSSS
VVNGSLPRERLVHQAVEDLPQGVDPACKEFYLSDSDFQDIFGKSKEEFYSMAKWKQLQEK
KKLGLF
Download sequence
Identical sequences A0A061I471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]