SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A061I4X6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061I4X6
Domain Number 1 Region: 2556-2771
Classification Level Classification E-value
Superfamily GFP-like 3.14e-65
Family Domain G2 of nidogen-1 0.001
Further Details:      
 
Domain Number 2 Region: 408-505
Classification Level Classification E-value
Superfamily Immunoglobulin 1.67e-25
Family I set domains 0.0055
Further Details:      
 
Domain Number 3 Region: 1173-1273
Classification Level Classification E-value
Superfamily Immunoglobulin 4.88e-25
Family I set domains 0.0027
Further Details:      
 
Domain Number 4 Region: 1877-1971
Classification Level Classification E-value
Superfamily Immunoglobulin 5.99e-24
Family I set domains 0.037
Further Details:      
 
Domain Number 5 Region: 1559-1650
Classification Level Classification E-value
Superfamily Immunoglobulin 1.3e-23
Family I set domains 0.011
Further Details:      
 
Domain Number 6 Region: 513-601
Classification Level Classification E-value
Superfamily Immunoglobulin 2.25e-23
Family I set domains 0.01
Further Details:      
 
Domain Number 7 Region: 982-1084
Classification Level Classification E-value
Superfamily Immunoglobulin 3.07e-23
Family I set domains 0.0054
Further Details:      
 
Domain Number 8 Region: 1077-1178
Classification Level Classification E-value
Superfamily Immunoglobulin 9.76e-23
Family I set domains 0.0078
Further Details:      
 
Domain Number 9 Region: 695-777
Classification Level Classification E-value
Superfamily Immunoglobulin 1.09e-22
Family I set domains 0.03
Further Details:      
 
Domain Number 10 Region: 227-313
Classification Level Classification E-value
Superfamily Immunoglobulin 1.53e-22
Family I set domains 0.0091
Further Details:      
 
Domain Number 11 Region: 319-402
Classification Level Classification E-value
Superfamily Immunoglobulin 1.95e-22
Family I set domains 0.016
Further Details:      
 
Domain Number 12 Region: 893-989
Classification Level Classification E-value
Superfamily Immunoglobulin 2.1e-22
Family I set domains 0.011
Further Details:      
 
Domain Number 13 Region: 2147-2246
Classification Level Classification E-value
Superfamily Immunoglobulin 2.12e-22
Family I set domains 0.01
Further Details:      
 
Domain Number 14 Region: 1786-1882
Classification Level Classification E-value
Superfamily Immunoglobulin 7.15e-22
Family I set domains 0.037
Further Details:      
 
Domain Number 15 Region: 1965-2062
Classification Level Classification E-value
Superfamily Immunoglobulin 9.99e-22
Family I set domains 0.017
Further Details:      
 
Domain Number 16 Region: 785-869
Classification Level Classification E-value
Superfamily Immunoglobulin 1.7e-21
Family I set domains 0.0052
Further Details:      
 
Domain Number 17 Region: 2239-2331
Classification Level Classification E-value
Superfamily Immunoglobulin 2.22e-21
Family I set domains 0.0079
Further Details:      
 
Domain Number 18 Region: 28-123
Classification Level Classification E-value
Superfamily Immunoglobulin 2.65e-21
Family I set domains 0.0096
Further Details:      
 
Domain Number 19 Region: 1374-1460
Classification Level Classification E-value
Superfamily Immunoglobulin 3.61e-21
Family I set domains 0.012
Further Details:      
 
Domain Number 20 Region: 1266-1366
Classification Level Classification E-value
Superfamily Immunoglobulin 7.57e-21
Family I set domains 0.0087
Further Details:      
 
Domain Number 21 Region: 1454-1553
Classification Level Classification E-value
Superfamily Immunoglobulin 8.22e-21
Family I set domains 0.038
Further Details:      
 
Domain Number 22 Region: 1639-1735
Classification Level Classification E-value
Superfamily Immunoglobulin 1.7e-20
Family I set domains 0.011
Further Details:      
 
Domain Number 23 Region: 2051-2148
Classification Level Classification E-value
Superfamily Immunoglobulin 1.95e-20
Family I set domains 0.017
Further Details:      
 
Domain Number 24 Region: 117-218
Classification Level Classification E-value
Superfamily Immunoglobulin 4.21e-19
Family I set domains 0.012
Further Details:      
 
Domain Number 25 Region: 2777-2922
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.39e-16
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 26 Region: 2328-2379
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000157
Family TSP-1 type 1 repeat 0.00032
Further Details:      
 
Domain Number 27 Region: 2439-2497
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000471
Family TSP-1 type 1 repeat 0.00031
Further Details:      
 
Domain Number 28 Region: 2383-2440
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000051
Family TSP-1 type 1 repeat 0.00026
Further Details:      
 
Domain Number 29 Region: 2497-2554
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000575
Family TSP-1 type 1 repeat 0.00021
Further Details:      
 
Domain Number 30 Region: 2922-3041
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000062
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 31 Region: 620-674
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000171
Family I set domains 0.042
Further Details:      
 
Domain Number 32 Region: 1725-1783
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000167
Family I set domains 0.058
Further Details:      
 
Domain Number 33 Region: 2-32
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000065
Family I set domains 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A061I4X6
Sequence length 3056
Comment (tr|A0A061I4X6|A0A061I4X6_CRIGR) Hemicentin-1-like protein {ECO:0000313|EMBL:ERE72246.1} KW=Complete proteome OX=10029 OS=Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus). GN=H671_5g15148 OC=Muroidea; Cricetidae; Cricetinae; Cricetulus.
Sequence
MSDMGRYTCVAVNAAGEKQRDIDLRVYVPPNIMGEEQNVSVLISQAVELICRSDAVPPPT
LMWLKDGRPLLKKPGLSISGNGSVLKIEDAQVQDTGRYTCEATNVAGKTEKNYNVNIWVP
PNIYGSDELVQLTAIEGNLITLLCESSGIPPPNLTWKKKDSLVLADSAGRVRILSGGRRL
QISVAEKADAGLYTCMASNVAGIAKKDYNLQVYIRPSIANSGSHSPESIVIRGKSISLEC
EAQGIPQPTVTWMKDGRPLTKGKGVEILDEGRILQLKNVHVSDTGRYVCVAVNVAGMTDK
RFDLSVHAPPSIIGNQGVPENISVVEKSSVSLTCEASGIPLPSITWLKDGWPISLGSSVK
ILSGGRMLRLMQTRPEDAGQYTCIVRNAAGEERKMFGLSVLGTCVFCIPPHIVGENTLED
VKIKEKQSVTLTCEATGNPVPKITWHKDGQLLQEDEVHHMMSDGRFLQITNAQVSQTGRY
TCLASNTAGDKSKSFSLNVFVSPTIAGVDSEGSPEDVIVILNSPTSLVCEAYSYPPATIT
WFKDGAPLESNRNIRILPGGRTLQILNAQEDNAGRYSCVATNEAGEMIKHYEVKVYIPPI
IKKGDLLGPGLSPKEVKIRPLKSDDHVNIAANGHTLQIKEAQISDTGRYTCVASNLAGED
ELDFDVNIQVPPSFQKLWEIGNMLDTGRSGEAKDVIINNPISLHCETNAAPPPTLTWYKD
GRPLTSSDRVLILPGGRVLQIPRAKVEDAGRYTCVAVNEAGEDSLQYDVRVLLPPVIKGA
NGDLPEEVTVLVNKSARVECSSSGSPAPKNSWQKDGQPLLEDEHHKFLSDGRILQILNAQ
ITDIGRYVCVAENIAGSAKKYFNLNIHDHKEFEHVSLILSKFTFNIHMCTFTVPPSVIGP
THEHLSVVVNHFISLTCEVSGFPPPDLSWLKNEQPIKPNTNVLIVPGGRTLQIIRTKVSD
GGEYTCIAINQAGEGKKKISLTVHVPPSIKDHGSESLSVVNVREGTSVSLECESNAVPPP
VITWSKNGRTITDSTHVEILTGGQMLHIKRAEVSDTGQYVCRAINVAGRDDKNFHLNVYV
PPTIEGPEREVIVETVSNPVTLTCDATGIPPPTIIWLKNHKPIENSDSLEVHILSGGTKL
QIARPQRSDSGNYTCVASNMEGKAQKNYILFLQVPPTIASAEVPSEVSVILGENVELVCN
ADGIPTPHLQWLRDGKPILNGETERVSITADGSTLNIHRALTSDMGKYTCVATNPAGEED
RIFNLNVYVPPKIRGNKEEAEKLMALVDSSVNIECKAVGTPPPQINWLKNGLPLPLSSHV
RLLSAGQVVRIVRAQVSDVAVYTCVASNRAGVDSKHYSLQVSVPPNMDNAMGTEEIAIVK
GSSTSMTCFTDGTPTPSMSWLKDGQPLVLDAHLTIGTQGMVLQLIKAETEDSGKYTCVAS
NDAGEISKHFVLKVLEPPHINGSEGPGEVSVIVNNPLELSCIASGIPAPKVSWMKDGRPF
LQTDQVQILEGGAILRVSSAEVEDTGRYTCLASSPAGDDDKEYLVRVHVPPNIAGMDESQ
DFTVLRNRQVTLECKSDAVPPPVIMWLKNGEQLQATPRVRILSGGRYLQINNADLGDTAN
YTCVASNIAGKTTREFILTVNVPPSISGGPQSLVTLLNKSIVLECSAEGVPTPRMTWRKD
GAVLAGSHTRLLSSGSLVIISPSVDDTASYECTVTSDAGEDKRTVHLTVQVPPAIADEPT
DFLVTRQAPAVMTCTASGVPVPSVHWTKNGIRLLPRGDGYRILSSEPPVIQPQPSELDVI
LNNPILLPCEAAGTPSPFITWQKEGINVIASGKSLAVLPSGSLQISRAVREDAGTYMCVA
QNSAGTALGKIKLNVQVPPAITSHQKEYVVAVDKPVSLLCEAEGFPSPDITWHKDGHALT
ESIRQRILNSGALQIAFAQPDDAGRYTCMAANAAGSSSVSTTLTVHVPPKIQSTEVHYTV
NENSQAVLPCVADGIPTPAIHWEKDSVLIANLLGKYTAQPYGELILENVVLEDSGTYTCV
ANNAAGEDTHTVTLTVHSLPTFTELPGDLSLNKGEQLRLSCKATGIPLPKLTWTFNNNII
PAHFDSVNGHSELVIEKVSTEDSGTYVCTAENSVGFVKAIGFVYVKEPPVFKGDYPSNWI
EPLGGNAILNCEVRGDPAPTIQWSRKGADIETSHRIRQLGNGSLAIYGTVNEDAGDYTCV
AANEAGVVERSMSLTLQSPPIITLEPVETVVDAGGRVILDCQAMGEPQPIITWSRQGHPI
PLDNRLTMLSNSSLYITAARKEDTSEYECVARNFMGSVLVRVPVIVQVHGVWSVWQPWGA
CSKSCGKGSQTRTRLCNNPPPSFGGAYCSGVETQMQVCNERHCPVDGKWASWASWSACTV
SCGGGARKRTRDCSDPVPQHGGSKCEGSDVQSDFCNSDPCPTHGNWSPWSGWGTCSRTCN
GGQMRRYRTCDNPRPSNGGRACGGPDTQIQRCNTDMCPVDGSWGTWHSWSHCSVSCGGGE
RVRKRLCDNPVPSKSGRSCPGDATQVSRCNTQACPGGPLRARGSVIGNINDVEFGIAFLD
ATITDSPSTDTRIIQAKITNVPRSLGPAMRKIISILNPIYWTTAKEIGEAVNGFTLTNAV
FKRETQVEFATGEVLRMTHVARGLDSDGALLLDVIVNGYILQLQSPAEVSVKDYTEDYIQ
TGPGQLYAYSTRLFTVDGISVPYTWNHTIFYDQAWGKMPFLVETLHASSVESDYNQLEET
LGFKIHASISKGDRSNQCPSGFTLDSVGPFCADEDECAAGNPCSHACHNAIGAYYCSCPK
GLTIAADGRTCQDIDECALGGHTCRAGQDCDNTIGSYRCVVHCGAGFRRTSDGLSCQDVN
ECQESSPCHQRCFNVIGSFHCGCDAGYQLKGRKCIDVNECRQNVCRPDQHCKNTRGGYKC
IDLCPNGMTKAENGTCVDIDECKDGTHQCRYNQICENTRGSYRCACPRGYRSQGVGRPCI
DIDECQNRDTCQHECKNTIGSYQCVCPPGYRLMLNGKTCQDLTYLTVSHEFTARIL
Download sequence
Identical sequences A0A061I4X6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]