SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A061I7T6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061I7T6
Domain Number 1 Region: 577-632
Classification Level Classification E-value
Superfamily Tetraspanin 0.000000275
Family Tetraspanin 0.02
Further Details:      
 
Domain Number 2 Region: 345-375
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000942
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A061I7T6
Sequence length 669
Comment (tr|A0A061I7T6|A0A061I7T6_CRIGR) Tetraspanin containing protein {ECO:0000313|EMBL:ERE74772.1} KW=Complete proteome OX=10029 OS=Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus). GN=H671_4g13184 OC=Muroidea; Cricetidae; Cricetinae; Cricetulus.
Sequence
MDEPPQEAPNGSLDNKDTAQSPNNQKTYIEEGAGQDPHTGSENTGVGSSEQTSDKASSQT
ANEGSGWTDPRTSEEASQPSEHRGTSQQIDRRSSGQTERKTSETYNQQLPSLFEGKAYEK
TDDRASLPFGGKAFEQTDQGTWEFGDQTSSDQADYRTSGRSQYQVYNEVDYLPEDFSGQH
RFSGDQERDYRDYVRMKRDAQMADYRSYYKTLAQTENRSLSEIVDNKEVREADFKIQPCT
FEVSQTDLRSKVSASWETESAATVQGYKPPEAEFTTDTQSSYGKLPSITTKVYYSSSQEK
AQTTELPTDVVAEFEQRKSSQRQSEDSKRLFPPIVFEDPYQVALRYMEKHNILQIFQQIT
ENLVYEKPDDPLDFMLGQVWSGREHPLYSPCQKTAHTQAVAVPYEHYFIIYCPWEYNLWL
QKLNLALILCNLWETLKMAKDDSTVRCFQGLLIFGHVIVGMCGIALTAECIFFVSDQHSL
YPLLEATNNDDIYGAAWIGMFVGICLFCLSVLAIVGILKSNRKILLAYFIMMFIVYGFEV
ASCITAATQRDFFTANLFLKQMLVRYQNNSPPTNDDEWKNNGVTKTWDRLMLQEHCCGVN
GPSDWQKYTSAFRVENNDADYPWPRQCCVMNKLKEPLNLDACKLGVPGYYHNQFWVLLGT
MFYWSRIEY
Download sequence
Identical sequences A0A061I7T6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]