SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A061IA14 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061IA14
Domain Number 1 Region: 854-934
Classification Level Classification E-value
Superfamily DEATH domain 2.83e-20
Family DEATH domain, DD 0.00017
Further Details:      
 
Domain Number 2 Region: 368-418
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000929
Family TSP-1 type 1 repeat 0.00046
Further Details:      
 
Domain Number 3 Region: 278-369
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000194
Family I set domains 0.025
Further Details:      
 
Domain Number 4 Region: 422-476
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000157
Family TSP-1 type 1 repeat 0.00062
Further Details:      
 
Domain Number 5 Region: 170-273
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000191
Family I set domains 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A061IA14
Sequence length 944
Comment (tr|A0A061IA14|A0A061IA14_CRIGR) Netrin receptor UNC5A {ECO:0000313|EMBL:ERE80159.1} KW=Complete proteome OX=10029 OS=Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus). GN=H671_3g9061 OC=Muroidea; Cricetidae; Cricetinae; Cricetulus.
Sequence
MCPLLQQPDFGYGWIQDVSDFMLPVRLEKTSISPPSEAGDDKVATGLASVLNSEAMGTTR
WIPVYGPVFRRESWGGPRCALTSLMDGSHTRFSVKNPLVAVVENSTQIDFNKAPINPCVS
GNCCSLEGRPGQQAVCLRKTRLISSLPPAGAQQSATVASPVPGASPDLLPHFLVEPEDVY
IVKNKPVLLVCKAVPATQIFFKCNGEWVRQVDHVTERSTDGSSAGLPTMEVRINVSRQQV
EKVFGLEEYWCQCVAWSSSGTTKSQKAYIRIAYLRKNFEQEPLAKEVSLEQGIVLPCRPP
EGIPPAEVEWLRNEDLVDPSLDPNVYITREHSLVVRQARLADTANYTCVAKNIVARRRSA
SAAVIVYVNGGWSTWTEWSVCSASCGRGWQKRSRSCTNPAPLNGGAFCEGQNVQKTACAT
LCPVDGSWGSWSKWSACGLDCTHWRSRECSDPAPRNGGEECRGADLDTRNCTSDLCLHTA
SGPEDVALYIGLVAVAVCLILLLLVLILIYCRKKEGLDSDVADSSILTSGFQPVSIKPNK
ADNPHLLTIQPDLSTTTTTYQGISLLIPPDAIPRGKIYEIYLTLHKPEDVRLPLAGCQTL
LSPIVSCGPPGVLLTRPVILAMDHCGEPSPDSWSLHLKKQSCEGSWEDVLHLGEESPSHL
YYCQLEAGACYVFTEQLGRFALVGEALSVAATKRLKLLLFAPVACTSLEYNIRVYCLHDT
HDALKEVLQLEKQLGGQLIQEPRVLHFKDSYHSLRLSIHDVPSSLWKSKVLVSYQEIPFY
HIWNGTQQHLHCTFTLERVNPSTSDLACKVWVWQVEGDGQSFNINFNITKDTRFAELLAL
ESEGGVPALVGPSAFKIPFLIRQKIITSLDPPCSRGADWRTLAQKLHLDSHLSFFASKPS
PTAMLLNLWEARHFPNGNLGQLAAAVAGLGQPDAGLFTVSEAEC
Download sequence
Identical sequences A0A061IA14

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]