SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A061IEG3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061IEG3
Domain Number 1 Region: 222-330
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.1e-28
Family Ras-binding domain, RBD 0.0000359
Further Details:      
 
Domain Number 2 Region: 47-150
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 7.07e-28
Family Regulator of G-protein signaling, RGS 0.00038
Further Details:      
 
Domain Number 3 Region: 166-236
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.92e-20
Family Ras-binding domain, RBD 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A061IEG3
Sequence length 446
Comment (tr|A0A061IEG3|A0A061IEG3_CRIGR) Regulator of G-protein signaling 14-like protein {ECO:0000313|EMBL:ERE80478.1} KW=Complete proteome OX=10029 OS=Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus). GN=H671_3g8833 OC=Muroidea; Cricetidae; Cricetinae; Cricetulus.
Sequence
MVLAVSDGELTSTAGSQGQSEGRGSSLSIHSLPSGPSSPFSTEDQPVASWALSFERLLQD
PLGLAYFTEFLKKEFSAENVTFWKACERFQQIPASDTKQLSQEAHNIYHEFLSSQALSPV
NIDRQAWLSEEVLAQPRPDMFRAQQLQSHRKSLGSAEGESESRPGKYCCVYLPDGTASLA
LARPGLTIRDMLAGICEKRGLSLPDIKVYLVGNEQKALVLDQDCTVLADQEVRLESRITF
HSRVLYRLEFANLERVVRISAKPTKRLQEALQPILEKHGLSLEQVVLHRPGEKQLLDLEK
LVSSVASQTLVLDILPGAKMREASSTSPCRSQGCLPRTQDKGTHLPPLPPSLLVEDASSS
TGKRQTCDIEGLVELLNRVQSSGAHDQRGLLRKEDLVSATGTEFGYSDKNCNPRPGEMAP
WFRALAALPEHLGLILSTHVAAHTHL
Download sequence
Identical sequences A0A061IEG3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]