SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A061ILW3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061ILW3
Domain Number 1 Region: 1285-1417
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.86e-38
Family PLC-like (P variant) 0.0018
Further Details:      
 
Domain Number 2 Region: 1058-1111,1162-1274
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.36e-38
Family Dual specificity phosphatase-like 0.0000245
Further Details:      
 
Domain Number 3 Region: 337-387
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000222
Family TSP-1 type 1 repeat 0.00074
Further Details:      
 
Domain Number 4 Region: 915-1048
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000188
Family Voltage-gated potassium channels 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A061ILW3
Sequence length 1423
Comment (tr|A0A061ILW3|A0A061ILW3_CRIGR) Thrombospondin type-1 domain-containing protein 1 isoform 1 {ECO:0000313|EMBL:ERE88737.1} KW=Complete proteome OX=10029 OS=Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus). GN=H671_1g2832 OC=Muroidea; Cricetidae; Cricetinae; Cricetulus.
Sequence
MLKDFSHLLLVVLCDYVLGEAEYLLLREPVHVALSNRTVSVDFHYLGDVNGTLRNVSVML
WKANTNQTLTTKYLLTNQSQGTLQFECVYFKEAGDYWFVMIPEVTDNSTQVPGWEKSAFL
KVEWPVFHIDLNRTAKAAEGTFQVGLFTTQPLCLFPVGKPDLLVDVIFTDSLPEARTRGQ
PLEIRASKKTELAQGQWVEFGCAPVGVEAYVTVALKLWGQDSLIASTGPIDLAEKFGYKL
TMAREVTCESVVEVMVLPPPCVFVQGVLTVYKEAPRQAEERTFQLAENSLSLGQRRTVFN
CTLFDVGKNKYCFNFGISRKSHFSAKECMLIQRNIETWGPWQPWSQCSTTCGDAVRERRR
VCLSSVPSRPSCSGISSETSSCSLEECAVFWPPGPSSIPPQGPMKSNNVVTVTGISLCLF
IIIATVLITLWRRFGRAPKCSTPARHNSIHSPGFRKNSDEENICELSEPRGSFSDAGDGP
RGSPGDTGIPLTYRCSAPAAPDDEASGSESFQSNAQKIIPPLFSYRLAQQQLKEMKKKGL
TETTKVYHVSQSPLTDTVVDATASPPLDLECPEEAATASKFRIKSPFLDQPVAGTGERPP
SRLDCIVPPPSCAVSPSQTLIRKSQMRSTGAREGSSERCHPRTSLFRRTASFHETKQSRP
FRERSLSALTPRQVPTYSSRMRTWDQVEDRCRPPSRSAHLLPERSEHFQGAGRANSPLGP
LSKSCTVGHPRRKPDSGDRQAGLVAGAERMEPHRAHRGPSPSHRSVSRKQSSPIFPKDSY
QKVSQLSPSHCRKDKCQSFPIHSEFAFYDNTSFRLTEAEQRMLDLPGYFGSNEEDETTST
LSVENYGTNEDALTNNGSSIGSIASSDITSDIQEESINKSKLRQVSKFYDGDECIDIRKT
YHNTIKEVVLFLVSSVAFRVFGIMLIFLDIVFVSIDLHLVKNQLYIPLEYRSVSFAIALF
FLVDVLLRVYVEGRQQYFSDLLNTLDAVVIGVTVFIAFTYIFYDKKFLGDNPRLAVLFRP
LWLLILVRILQLAHQKRHLEKLTRRLVSGNKRRYKKDGFDLDLTYVTERIIAMSFPSSGR
QSFYRNPIKEVVRFLDTKHPNHYQVYNLCSMYTTNFCVTVGREQIGFAGSSLTLHSLSPP
PMLPISSGDLDPFPFSRGPCENSYDPKYFHYRVRRIMIDDHNVPTLEEMLLFSKEVNDWM
AQHPENVVAIHCKGGKGRTGTMVCACLIASEIVLNAKESLYFFGERRTDKASSSKFQGVE
TPSQNRYVKYFEKLKISYQWTLPARKMLMIKRFILYSIHGVGKGDGSDLEVQVVMWQETV
FSCFSSKNCMIFHDVETDRVIINVFNCPALYDDVKVKFLSPNLPSYYDDCPFFFWFHTAF
IRNNRLYLPRHELDNTHKSKTWKIYSPKFAVEVYFAEPMPRVL
Download sequence
Identical sequences A0A061ILW3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]