SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A061INM0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061INM0
Domain Number 1 Region: 933-991
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000824
Family TSP-1 type 1 repeat 0.004
Further Details:      
 
Domain Number 2 Region: 95-126
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000366
Family TSP-1 type 1 repeat 0.0021
Further Details:      
 
Domain Number 3 Region: 995-1046
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000523
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 4 Region: 746-804
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000575
Family TSP-1 type 1 repeat 0.0056
Further Details:      
 
Domain Number 5 Region: 805-862
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000209
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 6 Region: 866-929
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000746
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A061INM0
Sequence length 1095
Comment (tr|A0A061INM0|A0A061INM0_CRIGR) ADAMTS-like protein 4 {ECO:0000313|EMBL:ERE89874.1} KW=Complete proteome OX=10029 OS=Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus). GN=H671_1g2049 OC=Muroidea; Cricetidae; Cricetinae; Cricetulus.
Sequence
MRVGLFAQHSLLGEGAAKASSGQDYVYWVDHGEAAGTDLGEQREAGGGEGTSIGQERDRL
WLCVMLFLPLLQLCRNQELFGPSLQTPAEEGQAPEGLWGHWGRWASCSQPCGVGVQRRSR
TCELRPGLPLPPRPPRHPEALRPRGQSSRPQVSRGPQSLHRPQPRGRGGPLQGPASHLGR
EKTQETPGAQRSRGRDPIKPGMFGYGRVPFALPLHRSRRHPSRPEQPKNSSTWAEALPSQ
PPSTELASANHSSQMQLPELHAPSRSPEAETPRTGSTQIEVPPRSSPAPSDTGIPSPMSF
FGDSRSFQGSPGPRMPTSQGWNSPQGTERHPHPFPSVPRSRGQQSRGHGRPRGSFHRSPD
GWLPLTRDSSPLWSLFAPSSPVPKCSGENEQLRACSQEPCPPEQPDPRALQCAAFDSQEF
MGQLYQWEPFTEVQGSQRCELNCRPRGFRFYVHHTEKVQDGTLCQPGSLDICVAGRCLSP
GCDGILGSGRRPDGCGVCGGDGSTCHLVSGNLTDRGGPLGYQKILWIPAGASRLKISQLR
PSSNYLALRGPGGRSIINGNWAVDPPGSYSAVGTVFQYNRPPREEGKGESMSAEGPTTQP
VDVYMIFQEDNPGVSYQYVIASPPAVLESPSTKPPAFQLQPEMLSGEALLASAPRPVRAP
GTLQRQVRIPQVPVVTHTRTSLGTAAGYWKQVGHSECSASCGKGVWHPIFLCISRESGEE
LDEQNCAMGARPPASPEPCHGPPCPPYWEAGEWTSCSQSCGPGTQHRQLLCRQEFGDGGS
SVPPERCGHLPRPNVTQPCQLHLCGHWEISSPWSQCSVRCGRGQRSRQVRCVGSNGDEVS
KQECASGPPPPPSREACDMGPCTTAWFYSDWSSKCSAECGTGIQRRSVVCLRSGETLQED
QEAGAGSTEHGCPLRSRPPDMRACSLGPCERTWRWYTGPWSECSSECGSGTQHRDIICVS
KLGAEFNVTSPSNCSHLPRPPALQPCQGQACEDRWFSTPWSPCSRSCQGGMQTRDVQCLS
ANQTLSTRCPPRLRPSRKRSCNSQPCNQRPDDQCKDSSPHCPLVVQARLCVYPYYTATCC
RSCAHVLDRSQLEPA
Download sequence
Identical sequences A0A061INM0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]