SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A061INW2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061INW2
Domain Number 1 Region: 111-227
Classification Level Classification E-value
Superfamily YjeF N-terminal domain-like 2.22e-21
Family YjeF N-terminal domain-like 0.00029
Further Details:      
 
Domain Number 2 Region: 486-561
Classification Level Classification E-value
Superfamily Immunoglobulin 4.1e-17
Family I set domains 0.015
Further Details:      
 
Domain Number 3 Region: 340-385
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000157
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 4 Region: 406-483
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000765
Family Carboxypeptidase regulatory domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A061INW2
Sequence length 704
Comment (tr|A0A061INW2|A0A061INW2_CRIGR) Cartilage intermediate layer protein 1 {ECO:0000313|EMBL:ERE91172.1} KW=Complete proteome OX=10029 OS=Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus). GN=H671_1g1167 OC=Muroidea; Cricetidae; Cricetinae; Cricetulus.
Sequence
MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMFAVGIGTLFFGYWRMMKWNRERRRL
QIEDLEARIALMPLFQAEKDRRTLQILRENLEEEAIIMKDVPDWKLPDSACSTSEATALE
RELLDEYRFGWQQLVELYGHASAVAVTKAFPLSLLSRKQRTVLVVCGPEQNGAVGLACAR
HLRVFDYQPSIFCPVRSADTLHRDLTTQCEKMDIPFLSFLPAERIEAARGLPGPDPGQPS
PALEDWEEASEWTSWFNVDHPGGDGDFESLAAIRFYYGPARVCPRPLALEARTTDWALPA
SVGEQVHANPARGFWCLNREQPRGRRCSNYHVRFRCPLEAAWGPWGAWGLCSKSCGPGRR
LRRRSCQSSSGDTCLGNPQEAQKCVRSRCPGCSSDTCRCPDHILLGSVVTPSGRPLPGAR
VFLKARPGTIATSDTHGTFLVPGVCAGGQTNVSAQMDGFSTGTALAHANSSNSAVVTIVL
KELGKPYLVKHPESRVQEAGQNVTFCCKASGTPMPKKYSWFHNGTLLDRRQHGSGSHLEL
RGLREDQAGEYHCKAWNEAGAGSCRRVAVNALLQDYLARHPPTAPDDDPATFAMLAPLDA
LGHNYGVYTVTDQSPRLAKEIAIGRCFDGSSDGFSREMKADAGTAVTFQCREPRARPSLF
QRLLENPESALGDIRREMGQANRDSRLAQTQAGNTDPFGLPPGQ
Download sequence
Identical sequences A0A061INW2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]