SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A061J000 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061J000
Domain Number 1 Region: 88-255
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 6.54e-27
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.00075
Further Details:      
 
Domain Number 2 Region: 2-81
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.00000118
Family RNA editing terminal uridyl transferase 2, RET2, catalytic domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A061J000
Sequence length 347
Comment (tr|A0A061J000|A0A061J000_TRYRA) Uncharacterized protein {ECO:0000313|EMBL:ESL07620.1} KW=Complete proteome; Reference proteome OX=429131 OS=Trypanosoma rangeli SC58. GN=TRSC58_04688 OC=Herpetosoma.
Sequence
MQENYSSTHVDWNSNHQFATIEFASTTALIAALTQVKRHEGIDIPLRLPVDPRNGPEIYR
LPFDFCFSSIGLRNSYLLGNVLSHYEFSRHLLLLIKKWGRSSGVVNSIDGLLASYALTVM
CTHFLIKVGKIPKVSTLRSTDEPQLLPLFPDYRPLHDGKDSDVAELGFLTAAFFEYYSGI
FDYEKSVVCTTNTNLLKKTMRWEISPGLETGRPPFFEFAIKDPYGLDNIGRNLDREATEY
VRDAHIGALKSLLEGINDPEFTINTLIQSPPRPHRKNRTLASRGIASTNCSPDQLEAYHM
LKKMEFHERRKDMEQFGQKTVRRTEQQRVVSNVANDVLGWIRSDDSQ
Download sequence
Identical sequences A0A061J000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]