SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A061J7D4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061J7D4
Domain Number 1 Region: 15-50
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000968
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A061J7D4
Sequence length 72
Comment (tr|A0A061J7D4|A0A061J7D4_TRYRA) Uncharacterized protein {ECO:0000313|EMBL:ESL10784.1} KW=Complete proteome; Reference proteome OX=429131 OS=Trypanosoma rangeli SC58. GN=TRSC58_01477 OC=Herpetosoma.
Sequence
MNGKAAGHNISSIQKDQAYLHSHNVRGILERLVADVLREKPENVCEYLAAWAAHRRGGGG
GGPSSEAPSLTG
Download sequence
Identical sequences A0A061J7D4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]