SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A061JA94 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061JA94
Domain Number 1 Region: 7-47
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000000471
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0033
Further Details:      
 
Domain Number 2 Region: 90-161
Classification Level Classification E-value
Superfamily EF-hand 0.0000000014
Family Calmodulin-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A061JA94
Sequence length 172
Comment (tr|A0A061JA94|A0A061JA94_TRYRA) Uncharacterized protein {ECO:0000313|EMBL:ESL10182.1} KW=Complete proteome; Reference proteome OX=429131 OS=Trypanosoma rangeli SC58. GN=TRSC58_02089 OC=Herpetosoma.
Sequence
MESIFCLEQVNVPPELGTIMKQYTKAVLRDRPQDLYKYSANFFAALCGQAAPFDKDGQFV
ESREQEAMEQFAGAEVDRAEAVNSIFSVGYEETDAVREVFNHYDVNGNGRLATEKLPALL
ADLQRAVGLNESETMGKDILDALETDENGTVDLLELRQLFFQSVQLSLGNAE
Download sequence
Identical sequences A0A061JA94

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]