SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A061JG65 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061JG65
Domain Number 1 Region: 1-141
Classification Level Classification E-value
Superfamily Ribosomal protein L13 8.11e-46
Family Ribosomal protein L13 0.0000173
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A061JG65
Sequence length 158
Comment (tr|A0A061JG65|A0A061JG65_9PROT) 50S ribosomal protein L13 {ECO:0000256|HAMAP-Rule:MF_01366, ECO:0000256|SAAS:SAAS00766472} KW=Complete proteome; Reference proteome OX=1321371 OS=Holospora undulata HU1. GN=K737_300758 OC=Holosporaceae; Holospora.
Sequence
MQTFSLKAKDIEKKWYLIDAKGLVLGRLAAIVAQILNGKHKAVYSPHLDAGDRVIIINAE
KVHLTGDKLNQKQHYWHTNHPGGIKSRSAKEILQGRFPERLIQKAVERMMKKACPLRRER
IRGLFVYKGGENPHVAQCPKVLDVGAWDRKNLCKSGRG
Download sequence
Identical sequences A0A061JG65
WP_006290197.1.83832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]