SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A061JR05 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061JR05
Domain Number 1 Region: 30-193
Classification Level Classification E-value
Superfamily ISP domain 8.83e-41
Family Rieske iron-sulfur protein (ISP) 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A061JR05
Sequence length 197
Comment (tr|A0A061JR05|A0A061JR05_PSEST) Ubiquinol-cytochrome c reductase iron-sulfur subunit {ECO:0000256|RuleBase:RU004494} KW=Complete proteome OX=1218352 OS=Pseudomonas stutzeri KOS6. GN=B597_011640 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MSNDGVNAGRRRFLVAATSVVGAAGAVGAAVPFVGSWFPSAKAKAAGAPVKVNISKIEPG
QQMVAEWRGQPVFIVRRTDEILGNLEKVAPQVADPESKASVQPTYVDPKTRSIKPELLVI
VGLCTHLGCAPSFRPEVAAADLGADWLGGYFCPCHGSKYDLAGRVYKSQPAPLNLPVPPH
SYETDNVIIIGVDQENA
Download sequence
Identical sequences A0A061JR05
WP_003292493.1.36575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]