SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A061M276 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061M276
Domain Number 1 Region: 123-249
Classification Level Classification E-value
Superfamily Cyclophilin-like 3.3e-29
Family PH0987 C-terminal domain-like 0.0002
Further Details:      
 
Domain Number 2 Region: 7-99
Classification Level Classification E-value
Superfamily PH0987 N-terminal domain-like 1.57e-17
Family PH0987 N-terminal domain-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A061M276
Sequence length 293
Comment (tr|A0A061M276|A0A061M276_9BRAD) Urea amidolyase {ECO:0000313|EMBL:GAJ37524.1} KW=Complete proteome; Reference proteome OX=1126627 OS=Bradyrhizobium sp. DOA9. GN=BDOA9_0201410 OC=Bradyrhizobiaceae; Bradyrhizobium.
Sequence
MIYEQPKFLPAGDRYLLIEFGNEMNLELNFMAQGLAAAAAAANIKGVIETAPCFASLLVH
YEPTLIGYDDVVREFFRLSASLGSSEDIELESRLFYLPTHYLDPWTKACVDDYCAKIARK
VPDPELLVQENGLEDVNHLVRLHSSSEYWVASLGFWPGLPFLMALDPRARLTAPKYNPPR
THTPEGAIGLGGAANSIYPVATPGGYQIFARTPVPIWDATGKRSAFEGSLCLFRPGDRIK
FVPVTREDYDAAEEAVKEERYEYTIVEYQKFVVRNYNNWVSKVGEASNARVSA
Download sequence
Identical sequences A0A061M276
WP_025038426.1.83595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]