SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A061MN87 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061MN87
Domain Number 1 Region: 4-112
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 2.62e-38
Family N-utilization substance G protein NusG, N-terminal domain 0.00015
Further Details:      
 
Domain Number 2 Region: 120-176
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 6.52e-19
Family N-utilization substance G protein NusG, C-terminal domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A061MN87
Sequence length 176
Comment (tr|A0A061MN87|A0A061MN87_AGRRH) Transcription termination/antitermination protein NusG {ECO:0000256|HAMAP-Rule:MF_00948, ECO:0000256|RuleBase:RU000538, ECO:0000256|SAAS:SAAS00126873} KW=Complete proteome OX=1220581 OS=Rhizobium rhizogenes NBRC 13257. GN=RRH01S_02_04870 OC=Rhizobiaceae; Rhizobium/Agrobacterium group; Agrobacterium.
Sequence
MAARWYIVHAYSNFEKKVAESIEEKAKQKGLGHLFEKILVPTEKVVEVRRGRKVDSERKF
FPGYVLVRANLTDEAYHLIKNTPKVTGFLGSDNKPVPIPDYEADRILGQVQEGVERPKAS
VSFEIGEQVRVSDGPFASFNGTVQDVDEERSRLKVEVSIFGRATPVELEYSQVEKV
Download sequence
Identical sequences A0A061MN87 A0A071I4B2 B9JDR6 J2D8C7
gi|222085663|ref|YP_002544193.1| WP_007702181.1.25048 WP_007702181.1.39766 WP_007702181.1.44225 WP_007702181.1.44284 WP_007702181.1.49937 WP_007702181.1.55147 WP_007702181.1.56352 WP_007702181.1.78634 WP_007702181.1.85071 WP_007702181.1.88216 WP_007702181.1.91008 311403.Arad_1955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]