SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A061MWK2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061MWK2
Domain Number 1 Region: 2-64
Classification Level Classification E-value
Superfamily MbtH-like 2.62e-23
Family MbtH-like 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A061MWK2
Sequence length 66
Comment (tr|A0A061MWK2|A0A061MWK2_AGRRH) Uncharacterized protein {ECO:0000313|EMBL:GAJ96153.1} KW=Complete proteome OX=1220581 OS=Rhizobium rhizogenes NBRC 13257. GN=RRH01S_16_01020 OC=Rhizobiaceae; Rhizobium/Agrobacterium group; Agrobacterium.
Sequence
MWDDEEVDYFIVVNGEEQYSLWPAGSRLPEGWSIVGEPGSKQSRLERIAELWTDLRPRSL
RETKAG
Download sequence
Identical sequences A0A061MWK2
WP_042475877.1.44225 WP_042475877.1.55147 WP_042475877.1.88216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]