SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A061N0G6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061N0G6
Domain Number 1 Region: 14-134,161-175
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000471
Family SMI1/KNR4-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A061N0G6
Sequence length 181
Comment (tr|A0A061N0G6|A0A061N0G6_AGRRH) Uncharacterized protein {ECO:0000313|EMBL:GAJ96020.1} KW=Complete proteome OX=1220581 OS=Rhizobium rhizogenes NBRC 13257. GN=RRH01S_14_01740 OC=Rhizobiaceae; Rhizobium/Agrobacterium group; Agrobacterium.
Sequence
MTTLDAILRSGRVESFGKATSAALERLVNEHGVYLSQDYIHFLTRCNGLRTTFDFDGVKQ
LGLSMALADINTFYGVENGRDYADLLTIIPKMDASGRELLDFAPPIAVGGDFCTFVEITE
GSRVGEIMYTDGEMYWGYFEEADTDWTNTPDALISTFIEHGFFMPIAPSFNALLEMYGKL
V
Download sequence
Identical sequences A0A061N0G6 B9JEL0
311403.Arad_2178 WP_012651339.1.39766 WP_012651339.1.44225 WP_012651339.1.55147 WP_012651339.1.56352 WP_012651339.1.78634 WP_012651339.1.88216 WP_012651339.1.91008 gi|222085826|ref|YP_002544357.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]