SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A061QLH8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061QLH8
Domain Number 1 Region: 86-135
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000222
Family TSP-1 type 1 repeat 0.00049
Further Details:      
 
Domain Number 2 Region: 199-255
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000366
Family TSP-1 type 1 repeat 0.00039
Further Details:      
 
Domain Number 3 Region: 144-193
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000157
Family TSP-1 type 1 repeat 0.00046
Further Details:      
 
Domain Number 4 Region: 27-77
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000654
Family TSP-1 type 1 repeat 0.00058
Further Details:      
 
Domain Number 5 Region: 261-321
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000863
Family TSP-1 type 1 repeat 0.00093
Further Details:      
 
Domain Number 6 Region: 324-366
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000392
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A061QLH8
Sequence length 425
Comment (tr|A0A061QLH8|A0A061QLH8_CUPSA) Putative hemicentin {ECO:0000313|EMBL:JAC59259.1} OX=6928 OS=Cupiennius salei (American wandering spider). GN=CSH_0422 OC=Araneae; Araneomorphae; Entelegynae; Lycosoidea; Ctenidae; Cupiennius.
Sequence
MAAQRIVLLIPVLVFLTQLCVLEAFAVNGNWGKWMEWEPCSSSCGPGERRRMRFCNSPPP
SGGGASCAGSKIQYEECEAPIGCPRDGEWSDWDRWSACSVTCGEGTQSRRRKCDSPPPVN
GGRYCVGTADETITCESARQCPRDGQWSEWGEWAACSVTCGEGSSFRFRDCNNPPPNEFG
KDCPGDDQQRRACRARRGCAINGQWSEWSNWSQCSVTCGTGVVRRSRKCDRPIPQNGGLD
CNRELAGELQEQSCNGTERFCIVHGGWSAWGAWGECISPKCGSPDGIAYTLRQRSCNNPY
PDHKGDMCQGSFLHAGICNLPVNCPVDGQWGEWSEWKCTREFVTRKRVCDSPAPSNRGRD
CQGSKVELYAEGDVEFEKYCPDMMIDPDEEVKENNGNNEGNNEGNNEGNGNIDNDDYDYN
YEDEP
Download sequence
Identical sequences A0A061QLH8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]