SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A061S4I7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061S4I7
Domain Number 1 Region: 10-89
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000067
Family BAR domain 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A061S4I7
Sequence length 100
Comment (tr|A0A061S4I7|A0A061S4I7_9CHLO) Uncharacterized protein {ECO:0000313|EMBL:JAC77825.1} OX=582737 OS=Tetraselmis sp. GSL018. GN=TSPGSL018_15607 OC=unclassified Tetraselmis.
Sequence
MAEGEESGAQLESKHLGELQENKNELLLRVQSLKKELSDWRSKLDAQVKTYKNELGELRT
ALNQEVEQLRSEFQDLRTTLRQQLEATSDLAAGGEGESHE
Download sequence
Identical sequences A0A061S4I7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]