SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A061S6Y8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061S6Y8
Domain Number 1 Region: 115-122,183-292
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000000000654
Family Pseudo ankyrin repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A061S6Y8
Sequence length 340
Comment (tr|A0A061S6Y8|A0A061S6Y8_9CHLO) Ankyrin repeat protein r840-like {ECO:0000313|EMBL:JAC78610.1} OX=582737 OS=Tetraselmis sp. GSL018. GN=TSPGSL018_14707 OC=unclassified Tetraselmis.
Sequence
MDWTEAVVTAVLRQLEPNWRAVAKFVCKSLYSAVKFLESEAGEPFCLTPSEVCLTPELLA
WAYSKGCPWNEVISDAAAASGNVNTLRFAYENGCPWDEDVPTSAAGSGDIATLQFALEKG
CPRDEAAVCSEAACNGHVQLLAWARNSARLSWDRWTCAAAAEGGHLSLLAWAHEQGAPWD
EQTCIAAAREGHQHILSYAVSNGCPWNSDVCGEAAREGHLDLLRWLLDSGCPTSGTTVCT
SAAAGGQVPVLQFARXRGMEWSPDTTEAAAFNGQLEALQWCRQNGCPWDSRTAWAAANSG
NLELLQWVVKAGCPWELSIYEAALDEGHEEVAVWIENNLL
Download sequence
Identical sequences A0A061S6Y8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]