SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A061SDQ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A061SDQ2
Domain Number 1 Region: 76-254
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 1.16e-49
Family RNA editing terminal uridyl transferase 2, RET2, domain 2 0.016
Further Details:      
 
Domain Number 2 Region: 7-72
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.0000000000000024
Family RNA editing terminal uridyl transferase 2, RET2, catalytic domain 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A061SDQ2
Sequence length 264
Comment (tr|A0A061SDQ2|A0A061SDQ2_9CHLO) Nucleotidyltransferase family protein {ECO:0000313|EMBL:JAC83287.1} OX=582737 OS=Tetraselmis sp. GSL018. GN=TSPGSL018_3708 OC=unclassified Tetraselmis.
Sequence
MPEVGDDYAEKAKAVEAMGELLQDAGMQDVMTLSHARVPVVKFVHPTTQTKCDITVNNIL
ACINTKLLRDYAALDPRLRQLVFIIKHWAKRRKVNEAYTGTLSSYAYVLMCIHLLQQRDP
PVLPCLQSVAPPTFKRTVGSCCCDYFDNVSALSGFGSGNTETVSELLMAFFDYWAWGHDY
VNSVISIRTGGFLTKADKEWTKRVRNERHLVCIEDPFDVTHDLGRVVDRASSSVLREEFK
RAAEILSQSPNPLPELFEPFKQGG
Download sequence
Identical sequences A0A061SDQ2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]