SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A062D7P9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A062D7P9
Domain Number 1 Region: 20-132
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000209
Family SMI1/KNR4-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A062D7P9
Sequence length 139
Comment (tr|A0A062D7P9|A0A062D7P9_ACIBA) Uncharacterized protein {ECO:0000313|EMBL:KCX53625.1} KW=Complete proteome OX=1310625 OS=Acinetobacter baumannii 496487. GN=J524_3836 OC=Acinetobacter calcoaceticus/baumannii complex.
Sequence
MGLSKSWSDFGLSGPKNLNLDEILKIEFPFLYKSLVEYANPAYIEVGSFYYGDDETSISD
FFPLTQSYEYGSFLWCALDNSIIPKGILPFARYAGDFLICFDYRETKTSPKIILLDSFMS
EIYPISNNFKVFWSFYMSD
Download sequence
Identical sequences A0A009SGZ4 A0A062D7P9 A0A062F4M8
WP_033856735.1.11924 WP_033856735.1.22104 WP_033856735.1.25810 WP_033856735.1.27531 WP_033856735.1.34986 WP_033856735.1.37007 WP_033856735.1.37212 WP_033856735.1.37695 WP_033856735.1.43380 WP_033856735.1.4426 WP_033856735.1.44538 WP_033856735.1.46209 WP_033856735.1.47475 WP_033856735.1.52644 WP_033856735.1.60371 WP_033856735.1.6519 WP_033856735.1.69458 WP_033856735.1.70739 WP_033856735.1.73820 WP_033856735.1.76216 WP_033856735.1.78988 WP_033856735.1.85101 WP_033856735.1.87156 WP_033856735.1.87717 WP_033856735.1.9 WP_033856735.1.90593 WP_033856735.1.91299 WP_033856735.1.9154 WP_033856735.1.92230 WP_033856735.1.92513 WP_033856735.1.95118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]