SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A062DS51 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A062DS51
Domain Number 1 Region: 43-167
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000000955
Family SMI1/KNR4-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A062DS51
Sequence length 171
Comment (tr|A0A062DS51|A0A062DS51_ACIBA) Uncharacterized protein {ECO:0000313|EMBL:KCX62563.1} KW=Complete proteome OX=1310642 OS=Acinetobacter baumannii 1451147. GN=J541_1638 OC=Acinetobacter calcoaceticus/baumannii complex.
Sequence
MNEALRKIEILWSKELKHAVHRGEKTFFQFRCILNNGISPDRFDDIDLQLPTEFKEFLLV
SNGADLFKDEEYGQWGARIFSIDELQSSNKYYRELRPKDFTKGDLIIGEFYGDSDLLLLR
CDPESKDYGVVLIALPFDNRSDWYCSVNFEYFITDYVNFEGDKFWEMRTKK
Download sequence
Identical sequences A0A009GZV7 A0A009NAH8 A0A009RRY3 A0A010WJG5 A0A011JSG9 A0A022IXV0 A0A022KLP5 A0A062DS51 A0A062GI74 A0A062KS71 A0A127KGY8 A0A1H8XF85 A0A242S8C7 A0A255UF36
WP_005070062.1.100086 WP_005070062.1.10172 WP_005070062.1.10577 WP_005070062.1.11037 WP_005070062.1.13806 WP_005070062.1.14017 WP_005070062.1.15127 WP_005070062.1.15324 WP_005070062.1.1554 WP_005070062.1.15843 WP_005070062.1.16785 WP_005070062.1.17255 WP_005070062.1.17533 WP_005070062.1.19026 WP_005070062.1.19659 WP_005070062.1.19727 WP_005070062.1.20977 WP_005070062.1.21157 WP_005070062.1.21163 WP_005070062.1.21609 WP_005070062.1.22241 WP_005070062.1.22540 WP_005070062.1.23357 WP_005070062.1.23860 WP_005070062.1.24130 WP_005070062.1.25864 WP_005070062.1.27093 WP_005070062.1.28356 WP_005070062.1.28666 WP_005070062.1.30769 WP_005070062.1.31235 WP_005070062.1.32082 WP_005070062.1.33112 WP_005070062.1.33990 WP_005070062.1.34068 WP_005070062.1.34178 WP_005070062.1.34672 WP_005070062.1.35048 WP_005070062.1.35862 WP_005070062.1.3591 WP_005070062.1.38165 WP_005070062.1.38536 WP_005070062.1.3878 WP_005070062.1.39054 WP_005070062.1.40405 WP_005070062.1.41195 WP_005070062.1.41946 WP_005070062.1.42636 WP_005070062.1.44199 WP_005070062.1.44502 WP_005070062.1.44518 WP_005070062.1.44895 WP_005070062.1.45253 WP_005070062.1.45892 WP_005070062.1.46249 WP_005070062.1.47248 WP_005070062.1.47968 WP_005070062.1.48736 WP_005070062.1.49456 WP_005070062.1.52219 WP_005070062.1.53333 WP_005070062.1.54053 WP_005070062.1.54654 WP_005070062.1.55789 WP_005070062.1.5629 WP_005070062.1.56855 WP_005070062.1.57061 WP_005070062.1.5804 WP_005070062.1.58887 WP_005070062.1.59296 WP_005070062.1.59492 WP_005070062.1.59778 WP_005070062.1.6133 WP_005070062.1.61872 WP_005070062.1.61879 WP_005070062.1.62133 WP_005070062.1.64308 WP_005070062.1.65162 WP_005070062.1.6540 WP_005070062.1.65610 WP_005070062.1.66414 WP_005070062.1.68333 WP_005070062.1.68495 WP_005070062.1.69405 WP_005070062.1.70450 WP_005070062.1.70636 WP_005070062.1.72045 WP_005070062.1.72314 WP_005070062.1.72645 WP_005070062.1.74047 WP_005070062.1.74328 WP_005070062.1.74342 WP_005070062.1.75893 WP_005070062.1.77264 WP_005070062.1.77640 WP_005070062.1.79603 WP_005070062.1.8016 WP_005070062.1.82927 WP_005070062.1.8300 WP_005070062.1.83027 WP_005070062.1.83233 WP_005070062.1.84196 WP_005070062.1.8428 WP_005070062.1.8555 WP_005070062.1.8589 WP_005070062.1.86200 WP_005070062.1.87895 WP_005070062.1.89761 WP_005070062.1.90508 WP_005070062.1.90720 WP_005070062.1.90911 WP_005070062.1.91114 WP_005070062.1.9238 WP_005070062.1.93042 WP_005070062.1.9318 WP_005070062.1.93557 WP_005070062.1.9494 WP_005070062.1.95194 WP_005070062.1.9696 WP_005070062.1.97698 WP_005070062.1.98696 WP_005070062.1.98783 WP_005070062.1.99031 WP_005070062.1.99121 HMPREF0013_00664T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]