SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A062FCU7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A062FCU7
Domain Number 1 Region: 8-153
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000000000196
Family SMI1/KNR4-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A062FCU7
Sequence length 159
Comment (tr|A0A062FCU7|A0A062FCU7_ACIBA) SMI1 / KNR4 family protein {ECO:0000313|EMBL:KCX82023.1} KW=Complete proteome OX=1310633 OS=Acinetobacter baumannii 940793. GN=J532_3662 OC=Acinetobacter calcoaceticus/baumannii complex.
Sequence
MLQDIGDQYPNGAINKEIIENFAATLEVTFPPEYVELISQHDGIYPVISSFDYVDTDGEL
NISTLELGGYLYEPRIEGMQFPEGDDDYEGKLISFGATPSGNFICFDYRFPWINDQPKIV
LVLHDEFYDFGMNEGKRKVLYLADNFVHFINSLHEFIEY
Download sequence
Identical sequences A0A062FCU7
WP_031977784.1.15428 WP_031977784.1.2722 WP_031977784.1.38758 WP_031977784.1.4548 WP_031977784.1.49938 WP_031977784.1.55408 WP_031977784.1.62242 WP_031977784.1.63354 WP_031977784.1.70297 WP_031977784.1.71131 WP_031977784.1.77812 WP_031977784.1.80138 WP_031977784.1.90795 WP_031977784.1.98666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]