SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A062N3N1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A062N3N1
Domain Number - Region: 44-109
Classification Level Classification E-value
Superfamily Multimerization domain of the phosphoprotein from sendai virus 0.0759
Family Multimerization domain of the phosphoprotein from sendai virus 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A062N3N1
Sequence length 244
Comment (tr|A0A062N3N1|A0A062N3N1_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:KCY73543.1} KW=Complete proteome OX=1310833 OS=Acinetobacter sp. 796380-1375. GN=J732_3356 OC=Acinetobacter calcoaceticus/baumannii complex.
Sequence
MNGYKWKDSVSSKALALYSYERLNLSEKMLLNELLNSSSQIYKFNNDLNLIYEIAGLLFG
VSTERGTEILLRNMIEKCFEDIEKNKGKLKEIVEKHKVVFWLYWDNIKTNIFLKYSTFED
GEINNLTDYVTSELSDYDIKNDLRTIFSIWTGTSEKEWKLNNGWGYADTLNSLISSLGKE
DADTEWLKIFVKKLCSHVIGEIDTLSKYTIVELRKLLDLLISYNRPLAKVVIASSSDLPV
QRLS
Download sequence
Identical sequences A0A014BRL5 A0A014CD75 A0A014CEE5 A0A014CJ09 A0A014CS68 A0A014D817 A0A014F9G1 A0A062N3N1 A0A062SU09

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]